PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang02g12310.1
Common NameLR48_Vigan10g210300
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB_related
Protein Properties Length: 257aa    MW: 29449.3 Da    PI: 7.3394
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang02g12310.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.51.6e-132471148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd +l + +   G ++W+++++  g+ R++k+c++rw +yl
   Vang02g12310.1 24 RGPWTIEEDHKLMNFILNNGIHCWRAVPKLAGLLRCGKSCRLRWINYL 71
                     89******************************99************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.3E-201578IPR009057Homeodomain-like
PROSITE profilePS5129419.3921975IPR017930Myb domain
SMARTSM007171.5E-62373IPR001005SANT/Myb domain
SuperFamilySSF466893.28E-172493IPR009057Homeodomain-like
PfamPF002494.5E-122471IPR001005SANT/Myb domain
CDDcd001671.19E-42671No hitNo description
Gene3DG3DSA:1.10.10.602.1E-47996IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 257 aa     Download sequence    Send to blast
LFFCKRVGSK MGRQPCCDKV GLKRGPWTIE EDHKLMNFIL NNGIHCWRAV PKLAGLLRCG  60
KSCRLRWINY LRPDLKRGRT DNEIKNHWNT KIKKRLKVLG LDPLTLMPIE QKQQQSGDDD  120
KLKTEKQQKS TSKGSDQGVD SKPLDMHATG EEPKTEDKME EKKVTWDDTT GFLNNYEMLC  180
SQLELGSWLS QETKASTSSY CSSSFSLDDS SNLSVCESSY LQENSLQQWV EDLDSSLSWD  240
SFNPLHTDFP FLENRQ*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150440.0AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007151568.11e-132hypothetical protein PHAVU_004G057800g
TrEMBLA0A0L9VMB61e-162A0A0L9VMB6_PHAAN; Uncharacterized protein
TrEMBLA0A0S3T8K81e-162A0A0S3T8K8_PHAAN; Uncharacterized protein
STRINGGLYMA19G07830.11e-124(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF66253150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14340.14e-58myb domain protein 40
Publications ? help Back to Top
  1. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]